(data stored in ACNUC7421 zone)

EMBL: CP001402.PE137

CP001402.PE137       Location/Qualifiers
FT   CDS             120397..121266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0139"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40773"
FT                   /db_xref="GOA:C4KK32"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK32"
FT                   /protein_id="ACR40773.1"
FT                   /translation="MSHYTVRNIIEIILCGGRDLNPRRPSPAEPQSAVGDTPTPPRLKY
FT                   LDKLKEVVRTDENNREYNLEQFFEWCVKKRGNSEDTCKDYVSYLKRPLDKSKKWSVIAY
FT                   KLYYEFLGKEDKAKELKVEKKVNIPVYRVPSVEEINAVLNHEDERIRILYRLLLESGVR
FT                   LKEALFILNNYDSSLDQREDGFYVYTVNLVRKSKKSFYAFHVTPLKKTYITENIVDHAN
FT                   LPVRPKFIRKFVATKMLELGIPSEVVDFFQGRTPSSILSKHYLDLLTLAKKEYKKYIEW
FT                   LKNIYIPI"
     MSHYTVRNII EIILCGGRDL NPRRPSPAEP QSAVGDTPTP PRLKYLDKLK EVVRTDENNR        60
     EYNLEQFFEW CVKKRGNSED TCKDYVSYLK RPLDKSKKWS VIAYKLYYEF LGKEDKAKEL       120
     KVEKKVNIPV YRVPSVEEIN AVLNHEDERI RILYRLLLES GVRLKEALFI LNNYDSSLDQ       180
     REDGFYVYTV NLVRKSKKSF YAFHVTPLKK TYITENIVDH ANLPVRPKFI RKFVATKMLE       240
     LGIPSEVVDF FQGRTPSSIL SKHYLDLLTL AKKEYKKYIE WLKNIYIPI                   289
//

If you have problems or comments...

PBIL Back to PBIL home page