(data stored in ACNUC7421 zone)

EMBL: CP001402.PE138

CP001402.PE138       Location/Qualifiers
FT   CDS             121347..121586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40774"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK33"
FT                   /protein_id="ACR40774.1"
FT                   /translation="MICEFLPVEYKKRLLEIATIDDLIAVGYTKKSAYQAKEKGIISDE
FT                   KCEKLVYILGKKAFLILEEALYEFTDNIYQLEKS"
     MICEFLPVEY KKRLLEIATI DDLIAVGYTK KSAYQAKEKG IISDEKCEKL VYILGKKAFL        60
     ILEEALYEFT DNIYQLEKS                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page