(data stored in ACNUC7421 zone)

EMBL: CP001402.PE139

CP001402.PE139       Location/Qualifiers
FT   CDS             121596..121979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40775"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK34"
FT                   /protein_id="ACR40775.1"
FT                   /translation="MEDILKRVYKIIEVRDNVWEELQKRDLVIVKLIAIERFSKRRLNF
FT                   IPYESFLYYVGLVNVELIKYNNWNFFAILPPVINILKEKFKLGKFAMYTEVRDPTDRMH
FT                   IDRKVFVPVDEKDVLRARGDVVP"
     MEDILKRVYK IIEVRDNVWE ELQKRDLVIV KLIAIERFSK RRLNFIPYES FLYYVGLVNV        60
     ELIKYNNWNF FAILPPVINI LKEKFKLGKF AMYTEVRDPT DRMHIDRKVF VPVDEKDVLR       120
     ARGDVVP                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page