(data stored in ACNUC7421 zone)

EMBL: CP001402.PE142

CP001402.PE142       Location/Qualifiers
FT   CDS             complement(122418..126488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40778"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK37"
FT                   /protein_id="ACR40778.1"
FT                   /translation="MIYRPHFTYIEASIPNQVVAREAAANASKKREKERQIVIRPVQEW
FT                   RPPVTRHIVEEWRPPVIRPVNNEEIPAHRQNNGMLIGPHEQKSTDNRPKGVVTAPSPPP
FT                   RHGLGLPRREDNVPNGEPTLFTIRQNVLKDINRLGDLISQANETQTTTEPNLFTIRQNV
FT                   QNNVNRLSNSSEQTTSTQSTSTQNNVLGTSRINRFESGVKQTTGVRTNTSQQNNPQQMI
FT                   DQMISQGVNVTASVNPQQNIDQMISQGVNVSAGATPSGNIIAQGSTGSSGGGNPFGAIG
FT                   SFFSNVGKDISNAVQTVGSTVSNALGTVNNAINNAYNSAYGIQPTTPPQTLNLNAGTTT
FT                   NTQQMINQMVNQRNQVASTSSDTNPLQQFFNDIAKGSALVGYYATEGLGGVGEELANVV
FT                   TGHGLENFSQAVQQFNQAGGQNIARTVGNVTEVALPAIATAVVAPELLPAELIGEASSV
FT                   GLGEAISKITTGKWQSLPQVLQEANEGGILGVIGGAAGSAAEGALAKLGTMVGGKVGDI
FT                   LAGAGGKALAGAAVNEALTAPFTRNPEQLLTAGVLGALGGAASSFVHAEDVPVLEQSEA
FT                   VRNAIDTSEAGARLGNQIVNSAIKKGILDVEEINGRTTTEIGDVLRSKLNNLQSTVLSR
FT                   LNNDDLAALREKGVIDENGNVLKTEDFAKFVKGKLPEGKLYNETLKLLDEYNKGIEKIV
FT                   GGFKVSIGDRTLLYKLKAGDERDFGLGSAGKSDLFNKLRATSDIDKNVAGIYRTTSDVR
FT                   DTAVGLSRAGNVKDADLLMNVYKATKDLKVLHNLKPGDLDLEFKNLGDLSKPVGETIKD
FT                   YFSQPEFSNRVLIYGSNSIKQYLEDIATRYGGEFRGDLSKDYYYVVKGDKPVLALRKPG
FT                   DVDVFVRTDDPAELNKIAQDLADRLNKVAGTDRFEAQGHLVVDKVTGDHVADLHMQNEA
FT                   SDIHNLYARNQGSNLGMGDQTPYYVKEGDARLGVAKLSQMARTKANAIAELREASIEDV
FT                   LKQINEGIKVDDKNIDMIVKNVERLASSNDDAIAYFVKNIKDPELRDALAERFAEDLKL
FT                   TKDDLLNRNVNVDAIKDILTRKEQWISPASYRLKDAEDFLRLMKTEADLSGDPEKLALY
FT                   ERLEADFKERGWIPEDWKPEGTIDSETLEGAQRFMRSITSESTESAYVSTPPSIILPPS
FT                   SVIISTPPSPVTSPPPSPIISPPPSPITSPPPSPIISPPPSPVTSPPSSPITSPPPPPS
FT                   PPPPPPPRVIIPPSPIISPPPSPPPPPPPRVIIPPSPTISPPPSPSPPPPPIISPPPPP
FT                   PPPPPPPSPTEEVIIASQSPPPPVFSPSVILGSSPPPMGPPPFIATLPPGYMGFGGGER
FT                   REISGMAGEMIVL"
     MIYRPHFTYI EASIPNQVVA REAAANASKK REKERQIVIR PVQEWRPPVT RHIVEEWRPP        60
     VIRPVNNEEI PAHRQNNGML IGPHEQKSTD NRPKGVVTAP SPPPRHGLGL PRREDNVPNG       120
     EPTLFTIRQN VLKDINRLGD LISQANETQT TTEPNLFTIR QNVQNNVNRL SNSSEQTTST       180
     QSTSTQNNVL GTSRINRFES GVKQTTGVRT NTSQQNNPQQ MIDQMISQGV NVTASVNPQQ       240
     NIDQMISQGV NVSAGATPSG NIIAQGSTGS SGGGNPFGAI GSFFSNVGKD ISNAVQTVGS       300
     TVSNALGTVN NAINNAYNSA YGIQPTTPPQ TLNLNAGTTT NTQQMINQMV NQRNQVASTS       360
     SDTNPLQQFF NDIAKGSALV GYYATEGLGG VGEELANVVT GHGLENFSQA VQQFNQAGGQ       420
     NIARTVGNVT EVALPAIATA VVAPELLPAE LIGEASSVGL GEAISKITTG KWQSLPQVLQ       480
     EANEGGILGV IGGAAGSAAE GALAKLGTMV GGKVGDILAG AGGKALAGAA VNEALTAPFT       540
     RNPEQLLTAG VLGALGGAAS SFVHAEDVPV LEQSEAVRNA IDTSEAGARL GNQIVNSAIK       600
     KGILDVEEIN GRTTTEIGDV LRSKLNNLQS TVLSRLNNDD LAALREKGVI DENGNVLKTE       660
     DFAKFVKGKL PEGKLYNETL KLLDEYNKGI EKIVGGFKVS IGDRTLLYKL KAGDERDFGL       720
     GSAGKSDLFN KLRATSDIDK NVAGIYRTTS DVRDTAVGLS RAGNVKDADL LMNVYKATKD       780
     LKVLHNLKPG DLDLEFKNLG DLSKPVGETI KDYFSQPEFS NRVLIYGSNS IKQYLEDIAT       840
     RYGGEFRGDL SKDYYYVVKG DKPVLALRKP GDVDVFVRTD DPAELNKIAQ DLADRLNKVA       900
     GTDRFEAQGH LVVDKVTGDH VADLHMQNEA SDIHNLYARN QGSNLGMGDQ TPYYVKEGDA       960
     RLGVAKLSQM ARTKANAIAE LREASIEDVL KQINEGIKVD DKNIDMIVKN VERLASSNDD      1020
     AIAYFVKNIK DPELRDALAE RFAEDLKLTK DDLLNRNVNV DAIKDILTRK EQWISPASYR      1080
     LKDAEDFLRL MKTEADLSGD PEKLALYERL EADFKERGWI PEDWKPEGTI DSETLEGAQR      1140
     FMRSITSEST ESAYVSTPPS IILPPSSVII STPPSPVTSP PPSPIISPPP SPITSPPPSP      1200
     IISPPPSPVT SPPSSPITSP PPPPSPPPPP PPRVIIPPSP IISPPPSPPP PPPPRVIIPP      1260
     SPTISPPPSP SPPPPPIISP PPPPPPPPPP PSPTEEVIIA SQSPPPPVFS PSVILGSSPP      1320
     PMGPPPFIAT LPPGYMGFGG GERREISGMA GEMIVL                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page