(data stored in ACNUC7421 zone)

EMBL: CP001402.PE143

CP001402.PE143       Location/Qualifiers
FT   CDS             complement(126485..126712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40779"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK38"
FT                   /protein_id="ACR40779.1"
FT                   /translation="MKREGDVVIMNAPGGGVIKLKLEGHTLRVKEIQGGSERARYEIKL
FT                   NDQEYDTVRNVLKNAKSDEEVLQLFAGVIR"
     MKREGDVVIM NAPGGGVIKL KLEGHTLRVK EIQGGSERAR YEIKLNDQEY DTVRNVLKNA        60
     KSDEEVLQLF AGVIR                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page