(data stored in ACNUC7421 zone)

EMBL: CP001402.PE144

CP001402.PE144       Location/Qualifiers
FT   CDS             126751..127092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40780"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK39"
FT                   /protein_id="ACR40780.1"
FT                   /translation="MEKLNNRFVAEIEDDGVRVMRLENFFKLKCTLARKDIERVLNIIH
FT                   IILEYIPVANLEEETVFAVPFRYLEDVQFLAKLCNAKIEVMIKRRPRLAYVKWIPKDII
FT                   NNDAANDDE"
     MEKLNNRFVA EIEDDGVRVM RLENFFKLKC TLARKDIERV LNIIHIILEY IPVANLEEET        60
     VFAVPFRYLE DVQFLAKLCN AKIEVMIKRR PRLAYVKWIP KDIINNDAAN DDE              113
//

If you have problems or comments...

PBIL Back to PBIL home page