(data stored in ACNUC7421 zone)

EMBL: CP001402.PE145

CP001402.PE145       Location/Qualifiers
FT   CDS             127132..127446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40781"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK40"
FT                   /protein_id="ACR40781.1"
FT                   /translation="MNIGKLVVKKEYFYITVPEEAKEFPYYVVSRGRKNSIILKFFDDV
FT                   YLRKLKTWTFYEVREQFVRIPTRLIKEMGIQAGARYMINIKRRDEHMLKIELIFGPVRE
FT                   "
     MNIGKLVVKK EYFYITVPEE AKEFPYYVVS RGRKNSIILK FFDDVYLRKL KTWTFYEVRE        60
     QFVRIPTRLI KEMGIQAGAR YMINIKRRDE HMLKIELIFG PVRE                        104
//

If you have problems or comments...

PBIL Back to PBIL home page