(data stored in ACNUC7421 zone)

EMBL: CP001402.PE146

CP001402.PE146       Location/Qualifiers
FT   CDS             127443..127850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40782"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK41"
FT                   /protein_id="ACR40782.1"
FT                   /translation="MSWLKKEGYTKPIEARRFAYILEIPQTAVEKFNVGPLTRYKMSLK
FT                   KLDLIIRFIDDFRIAGTYVLSKKNAYYIPIPWDLASTHVILPNCVYKVELYEKGIVYRH
FT                   AGTFLKGKIVDDTEKHALYFALLDSEEKKFS"
     MSWLKKEGYT KPIEARRFAY ILEIPQTAVE KFNVGPLTRY KMSLKKLDLI IRFIDDFRIA        60
     GTYVLSKKNA YYIPIPWDLA STHVILPNCV YKVELYEKGI VYRHAGTFLK GKIVDDTEKH       120
     ALYFALLDSE EKKFS                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page