(data stored in ACNUC7421 zone)

EMBL: CP001402.PE147

CP001402.PE147       Location/Qualifiers
FT   CDS             complement(127991..128164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40783"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK42"
FT                   /protein_id="ACR40783.1"
FT                   /translation="MKPRIHKGGKPGQETYYLNIPREIVTSLDIKPDDEFELKVETKGD
FT                   EITLCYKRVKKS"
     MKPRIHKGGK PGQETYYLNI PREIVTSLDI KPDDEFELKV ETKGDEITLC YKRVKKS           57
//

If you have problems or comments...

PBIL Back to PBIL home page