(data stored in ACNUC7421 zone)

EMBL: CP001402.PE148

CP001402.PE148       Location/Qualifiers
FT   CDS             128219..128548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40784"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK43"
FT                   /protein_id="ACR40784.1"
FT                   /translation="MRANNCLNRRTNMPTQIQFGTNWVQVKGSIFYLTPHALRVVKEFY
FT                   EEAKADNIKVDIEYLAKAFELLKPESEAEAKKFIDILNEIYPETKEIIDRIYTNKNAYN
FT                   TVREL"
     MRANNCLNRR TNMPTQIQFG TNWVQVKGSI FYLTPHALRV VKEFYEEAKA DNIKVDIEYL        60
     AKAFELLKPE SEAEAKKFID ILNEIYPETK EIIDRIYTNK NAYNTVREL                   109
//

If you have problems or comments...

PBIL Back to PBIL home page