(data stored in ACNUC7421 zone)

EMBL: CP001402.PE150

CP001402.PE150       Location/Qualifiers
FT   CDS             128800..129159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0152"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40786"
FT                   /db_xref="GOA:C4KK45"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK45"
FT                   /protein_id="ACR40786.1"
FT                   /translation="MIDPLMMWKNPRLVMSYLKIFRSTFWRKITKSEPIKRIYHSAFWR
FT                   KNEKKRSVINLYIFSYKNKMTNMATNRPFVYIRLKEEDRKLLKEIAKKYDISESDVVKV
FT                   ALKKFAKELGVEVSS"
     MIDPLMMWKN PRLVMSYLKI FRSTFWRKIT KSEPIKRIYH SAFWRKNEKK RSVINLYIFS        60
     YKNKMTNMAT NRPFVYIRLK EEDRKLLKEI AKKYDISESD VVKVALKKFA KELGVEVSS        119
//

If you have problems or comments...

PBIL Back to PBIL home page