(data stored in ACNUC7421 zone)

EMBL: CP001402.PE151

CP001402.PE151       Location/Qualifiers
FT   CDS             129214..129624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40787"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK46"
FT                   /protein_id="ACR40787.1"
FT                   /translation="MSKFNYKKLSNKDNGVFLRISSERAVFKAVGDWHKTKSGFIAVPV
FT                   KIYAGVFKDFNGKKHTEGKGTLLLPGLIENYEDVMKALEDGEIIGVVCEKKEKDGKILY
FT                   YLNMYAIIENPEDIEDFMIDDINEEAKEDGED"
     MSKFNYKKLS NKDNGVFLRI SSERAVFKAV GDWHKTKSGF IAVPVKIYAG VFKDFNGKKH        60
     TEGKGTLLLP GLIENYEDVM KALEDGEIIG VVCEKKEKDG KILYYLNMYA IIENPEDIED       120
     FMIDDINEEA KEDGED                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page