(data stored in ACNUC7421 zone)

EMBL: CP001402.PE154

CP001402.PE154       Location/Qualifiers
FT   CDS             132859..133848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0156"
FT                   /product="transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40790"
FT                   /db_xref="GOA:C4KK49"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK49"
FT                   /protein_id="ACR40790.1"
FT                   /translation="MQGNKVKSFTLPIISYAVPTFVLVYPSFFVGWLSDSMHLAYWEVF
FT                   AIVALPFLGRIIGSFIYQLFKGSVVSYCFPLLGFLVVLQNFLGALVFVRFLVGVIFGLL
FT                   TSYAVESAVRSGRNVLVGFTTAGWSMGWVISYLAYSLLKNWNVITISGILIMFLALFEL
FT                   NKEEFRERGMSSVSFPRLTSILIYISALTPAFILQVMPSFLETIKLTWLILPSYLLSIP
FT                   TYVLLPMISGKVGIRKVLVISSIIVILSSIITFLLLPMMVIVFTSIGLGILGITPKYLA
FT                   IRGEDPKRMGLALNIGSVMGLIVPVLYALMPFSPEFLLSILMVLMLLI"
     MQGNKVKSFT LPIISYAVPT FVLVYPSFFV GWLSDSMHLA YWEVFAIVAL PFLGRIIGSF        60
     IYQLFKGSVV SYCFPLLGFL VVLQNFLGAL VFVRFLVGVI FGLLTSYAVE SAVRSGRNVL       120
     VGFTTAGWSM GWVISYLAYS LLKNWNVITI SGILIMFLAL FELNKEEFRE RGMSSVSFPR       180
     LTSILIYISA LTPAFILQVM PSFLETIKLT WLILPSYLLS IPTYVLLPMI SGKVGIRKVL       240
     VISSIIVILS SIITFLLLPM MVIVFTSIGL GILGITPKYL AIRGEDPKRM GLALNIGSVM       300
     GLIVPVLYAL MPFSPEFLLS ILMVLMLLI                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page