(data stored in ACNUC7421 zone)

EMBL: CP001402.PE155

CP001402.PE155       Location/Qualifiers
FT   CDS             133940..135013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0157"
FT                   /product="eRF1 domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40791"
FT                   /db_xref="GOA:C4KK50"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK50"
FT                   /protein_id="ACR40791.1"
FT                   /translation="MKALIKELKKWKAPATVLLSLYIPPGRPIPDVVNLLRQEYSIAQN
FT                   IKLKRTRDAVLSAIGAAIDRLNKIPKIDGNGLVLFCGENFDTEDFKCFMFSPPDKVPLF
FT                   FYRTDKEFHVEFLEDMVEDTVVYGLIIVERDEATIGLLKGTRIEILEEIEGFVPGKHMM
FT                   GGQSQRRIDRIIDEMYHNFLKEVGEKVNAYFMPFIQTGKMKGILLGGPGYAKEDFYKED
FT                   YVDYRIKNLILQPLIDVSDQGEVGLREMIMRAEDLLKNQQYVEVEKLLEELKYHLAKDD
FT                   GLIIYGKEQIKKAMEMGAVEAIVIHEDSSDKELEKLAQDAENYGVKVFVVGDEVPEAEW
FT                   VKKTFNGVVGKLRYRLY"
     MKALIKELKK WKAPATVLLS LYIPPGRPIP DVVNLLRQEY SIAQNIKLKR TRDAVLSAIG        60
     AAIDRLNKIP KIDGNGLVLF CGENFDTEDF KCFMFSPPDK VPLFFYRTDK EFHVEFLEDM       120
     VEDTVVYGLI IVERDEATIG LLKGTRIEIL EEIEGFVPGK HMMGGQSQRR IDRIIDEMYH       180
     NFLKEVGEKV NAYFMPFIQT GKMKGILLGG PGYAKEDFYK EDYVDYRIKN LILQPLIDVS       240
     DQGEVGLREM IMRAEDLLKN QQYVEVEKLL EELKYHLAKD DGLIIYGKEQ IKKAMEMGAV       300
     EAIVIHEDSS DKELEKLAQD AENYGVKVFV VGDEVPEAEW VKKTFNGVVG KLRYRLY          357
//

If you have problems or comments...

PBIL Back to PBIL home page