(data stored in ACNUC7421 zone)

EMBL: CP001402.PE158

CP001402.PE158       Location/Qualifiers
FT   CDS             136503..137291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40794"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK53"
FT                   /protein_id="ACR40794.1"
FT                   /translation="MFLLQQSEDSTSIRKLVKFLNINFPQIDLIVYGRGLELPSFTLAR
FT                   ALSSLKNKIISTLNIYDFLFIYNPYVEVSNVVAFTGDENELRELLDGLESLRVRGSIYH
FT                   CGVTDIKPRYNLISINSLDKTFCEINLSLSILKVLSNNKNTEREKRILDQLNDLSDLDD
FT                   YVKNYAKVFNPDLPILLSPVMLPAKSFLESLGINVSSYFDTKILDGAQIVYTGVDMYIT
FT                   RRMIFSLKSKGKKVTDVLIDVDPLLAPIYLSMIMFYLKKK"
     MFLLQQSEDS TSIRKLVKFL NINFPQIDLI VYGRGLELPS FTLARALSSL KNKIISTLNI        60
     YDFLFIYNPY VEVSNVVAFT GDENELRELL DGLESLRVRG SIYHCGVTDI KPRYNLISIN       120
     SLDKTFCEIN LSLSILKVLS NNKNTEREKR ILDQLNDLSD LDDYVKNYAK VFNPDLPILL       180
     SPVMLPAKSF LESLGINVSS YFDTKILDGA QIVYTGVDMY ITRRMIFSLK SKGKKVTDVL       240
     IDVDPLLAPI YLSMIMFYLK KK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page