(data stored in ACNUC7421 zone)

EMBL: CP001402.PE16

CP001402.PE16        Location/Qualifiers
FT   CDS             complement(11678..14716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40652"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD2"
FT                   /protein_id="ACR40652.1"
FT                   /translation="MSCYKRISETASDSSYIYQIFSCISENPLYINRLRFFKQVKDEID
FT                   RISKTKQSPEIISLVADWGQGKSTFLDIIDEYAKSKNISVIKVPFVELLSKTEDLLTFR
FT                   NNIYLIDEVESSVDYFAEYQNEIKDFWSKVKELANSTGNSIVYLSMTPSAYSKIFGTGG
FT                   LIYNLFSETYPSLLERIRKVSIENPSKLEFLLMLKCMLKMANVKDFKILQYMDLPYWVI
FT                   DQERRKYVRFFNDVLCDNLPNIDRIFNELARSEKGISLNSEGETIKLDTLTKMENELDS
FT                   QESSNLYRVLMSRIFTDEKLIIKQLEGHVVKGVLLPYLKWIEIFPKGQEYVEDFLLTYY
FT                   QDDFHVFLSDNIESVVYESIDTSKLKENIKKLTLFSKTEAYALSWNFFESVANTNIGGL
FT                   VVEFKSREIRDKALQFVNTYITDREKELESLEYFMEVLGIKIDSANRTRDYIRFLKIVD
FT                   RNDKITIILAKPSNEDEIKSLIKEIKESDDIIHGIILIEPQIGKEELSKTLDELSIPLI
FT                   ELKITTPKKRQLLYLLFSKIYGQSRIRLDSIELRLGDLKNSISSLLLKIRDNLNLKQLP
FT                   IPKNKRLIQSFNWIIFYPSIKMANADEVFDKVNDIINEKFRMYGSKQFHLEDIETSNTF
FT                   IEDVITYFYNNYIIKIRANYIDFEDLAGDSLSSFSKLFAGLIRQKYKQEAEDVVFNYIM
FT                   YYVNPQDTRRKDNKNNPLAFAYQIFNPDKKIGQNPTLDFLVYSSIVSGEVAKYLNKDSI
FT                   YMKINDQIRKIKEKLDNPYSAYGYFITAKKRGAAVRSLEEMREVIETYEKSCTENKDIR
FT                   LCYDYLYLSNIYLELLRETEKSVIETDKIVEEISKKLEVVEKAKRYVKINEKIEEIEKV
FT                   REIVRELKDNFKIHMDKLAKRIQEINERGETESFKRYLDYLLTTIHVEDNSNLYFILFK
FT                   LLKETLNGIAIVGEELKGTIVDEITSLSKVGIQLNNIETIVNELEKISPELPKLRENVE
FT                   RNTQKITQLIQEIKEVLEEHGFG"
     MSCYKRISET ASDSSYIYQI FSCISENPLY INRLRFFKQV KDEIDRISKT KQSPEIISLV        60
     ADWGQGKSTF LDIIDEYAKS KNISVIKVPF VELLSKTEDL LTFRNNIYLI DEVESSVDYF       120
     AEYQNEIKDF WSKVKELANS TGNSIVYLSM TPSAYSKIFG TGGLIYNLFS ETYPSLLERI       180
     RKVSIENPSK LEFLLMLKCM LKMANVKDFK ILQYMDLPYW VIDQERRKYV RFFNDVLCDN       240
     LPNIDRIFNE LARSEKGISL NSEGETIKLD TLTKMENELD SQESSNLYRV LMSRIFTDEK       300
     LIIKQLEGHV VKGVLLPYLK WIEIFPKGQE YVEDFLLTYY QDDFHVFLSD NIESVVYESI       360
     DTSKLKENIK KLTLFSKTEA YALSWNFFES VANTNIGGLV VEFKSREIRD KALQFVNTYI       420
     TDREKELESL EYFMEVLGIK IDSANRTRDY IRFLKIVDRN DKITIILAKP SNEDEIKSLI       480
     KEIKESDDII HGIILIEPQI GKEELSKTLD ELSIPLIELK ITTPKKRQLL YLLFSKIYGQ       540
     SRIRLDSIEL RLGDLKNSIS SLLLKIRDNL NLKQLPIPKN KRLIQSFNWI IFYPSIKMAN       600
     ADEVFDKVND IINEKFRMYG SKQFHLEDIE TSNTFIEDVI TYFYNNYIIK IRANYIDFED       660
     LAGDSLSSFS KLFAGLIRQK YKQEAEDVVF NYIMYYVNPQ DTRRKDNKNN PLAFAYQIFN       720
     PDKKIGQNPT LDFLVYSSIV SGEVAKYLNK DSIYMKINDQ IRKIKEKLDN PYSAYGYFIT       780
     AKKRGAAVRS LEEMREVIET YEKSCTENKD IRLCYDYLYL SNIYLELLRE TEKSVIETDK       840
     IVEEISKKLE VVEKAKRYVK INEKIEEIEK VREIVRELKD NFKIHMDKLA KRIQEINERG       900
     ETESFKRYLD YLLTTIHVED NSNLYFILFK LLKETLNGIA IVGEELKGTI VDEITSLSKV       960
     GIQLNNIETI VNELEKISPE LPKLRENVER NTQKITQLIQ EIKEVLEEHG FG              1012
//

If you have problems or comments...

PBIL Back to PBIL home page