(data stored in ACNUC7421 zone)

EMBL: CP001402.PE163

CP001402.PE163       Location/Qualifiers
FT   CDS             complement(140587..141099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40799"
FT                   /db_xref="GOA:C4KK58"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK58"
FT                   /protein_id="ACR40799.1"
FT                   /translation="MKASYTLPLSILMIVLPIVPGLVDSFIAFLVGALIDFIVAVYVLI
FT                   SEKPWANDIKTAISTLYFTALSTFADVAGVFFVMAYQDEYKFAIVTLTLSIPFIYNLFL
FT                   VLKSVLPNIIKRDMLYVGNGFFAFILVLIIGAIIGRAFITNFYALLPLYTGFLILAIIA
FT                   LFYFRKK"
     MKASYTLPLS ILMIVLPIVP GLVDSFIAFL VGALIDFIVA VYVLISEKPW ANDIKTAIST        60
     LYFTALSTFA DVAGVFFVMA YQDEYKFAIV TLTLSIPFIY NLFLVLKSVL PNIIKRDMLY       120
     VGNGFFAFIL VLIIGAIIGR AFITNFYALL PLYTGFLILA IIALFYFRKK                  170
//

If you have problems or comments...

PBIL Back to PBIL home page