(data stored in ACNUC7421 zone)

EMBL: CP001402.PE165

CP001402.PE165       Location/Qualifiers
FT   CDS             141988..142527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40801"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK60"
FT                   /protein_id="ACR40801.1"
FT                   /translation="MKILVMSNIRFPEPHVESMLSSIIKKEEPEVIVLNGDTTQCYWDY
FT                   ECPRVIDVLYVIRSIAPWAQIIYVQGDMDPHAIKCITAEPRYREEIIGTTMYIAEAASV
FT                   KYHIIHGHQGEIDQLRKSIGAGPWDWLVIGQYKRLEIDKLARVLYSGGITREFPPEARG
FT                   YVVITDSNFYIRNLRT"
     MKILVMSNIR FPEPHVESML SSIIKKEEPE VIVLNGDTTQ CYWDYECPRV IDVLYVIRSI        60
     APWAQIIYVQ GDMDPHAIKC ITAEPRYREE IIGTTMYIAE AASVKYHIIH GHQGEIDQLR       120
     KSIGAGPWDW LVIGQYKRLE IDKLARVLYS GGITREFPPE ARGYVVITDS NFYIRNLRT        179
//

If you have problems or comments...

PBIL Back to PBIL home page