(data stored in ACNUC7421 zone)

EMBL: CP001402.PE166

CP001402.PE166       Location/Qualifiers
FT   CDS             complement(142524..142760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40802"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK61"
FT                   /protein_id="ACR40802.1"
FT                   /translation="MIVVVKYRIMDNNIRKIVNSLRKIPFIKEILFYSGEKNSIFANNY
FT                   KIWEEGSDLNPIEEVYDVKILELARRMYFPTCG"
     MIVVVKYRIM DNNIRKIVNS LRKIPFIKEI LFYSGEKNSI FANNYKIWEE GSDLNPIEEV        60
     YDVKILELAR RMYFPTCG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page