(data stored in ACNUC7421 zone)

EMBL: CP001402.PE167

CP001402.PE167       Location/Qualifiers
FT   CDS             142854..143237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40803"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK62"
FT                   /protein_id="ACR40803.1"
FT                   /translation="MQLENKPIVVISSTNAEEIPNFIRAMFKDCRLNGSKKLIINFISS
FT                   ISYPEFIQNAREALLDNIDLGAYIYIWKPEEVDQMMKKILENRQDMKGIIIYCDDNNKY
FT                   TIEKILHKVPNSIKANIIKDYCK"
     MQLENKPIVV ISSTNAEEIP NFIRAMFKDC RLNGSKKLII NFISSISYPE FIQNAREALL        60
     DNIDLGAYIY IWKPEEVDQM MKKILENRQD MKGIIIYCDD NNKYTIEKIL HKVPNSIKAN       120
     IIKDYCK                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page