(data stored in ACNUC7421 zone)

EMBL: CP001402.PE169

CP001402.PE169       Location/Qualifiers
FT   CDS             complement(144609..146225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40805"
FT                   /db_xref="GOA:C4KK64"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK64"
FT                   /protein_id="ACR40805.1"
FT                   /translation="MGMDTENLTRKYYGYLKTLPNIKIFATTFSAESLFIMLRSFQLTF
FT                   DYLFSFALYSILLTIIFKNKIKLALFLMNLTAIPYLLLSLLPIAPFYAFGFFMPLMAYI
FT                   LLSSYKEIPSIVLSGITSYVPIIFYVKYSIIFLIYIIIIGLIFHFYIYTVNRKGVKILG
FT                   FKSTQVAVPFITAITEKNKVPLENFLNLVSVKTNLSVFMYKLDDFLFMIPQIHFGVFDS
FT                   VGSSRFVYDIEKTLRNNVVTVFHGPGSHELDLPSSAEVNKVMEAISKSTLERSNWYKAT
FT                   FYGISIEKRSTFDITSLEFDKFRVSFMERPEFGIDDLPSSLWKYMLSSNNYLIDCHNSF
FT                   LVKEYDNHEINSLKEFIMDQRGIKSTRKLLVGYAEGKLAKTCEGLCDSRIRVFTFDDRV
FT                   KRVSIVYIYANNSTKELNNAISSAVRQIVDKVILVTPDDHSCTGISLGITYSPATFCED
FT                   IVNKASELIKRSTENMKEINSIEYKVVKIKGVKILGKIISIMLKALEDVGSYTSKTFWI
FT                   PLVAPYVLLVVILLFQSLIKF"
     MGMDTENLTR KYYGYLKTLP NIKIFATTFS AESLFIMLRS FQLTFDYLFS FALYSILLTI        60
     IFKNKIKLAL FLMNLTAIPY LLLSLLPIAP FYAFGFFMPL MAYILLSSYK EIPSIVLSGI       120
     TSYVPIIFYV KYSIIFLIYI IIIGLIFHFY IYTVNRKGVK ILGFKSTQVA VPFITAITEK       180
     NKVPLENFLN LVSVKTNLSV FMYKLDDFLF MIPQIHFGVF DSVGSSRFVY DIEKTLRNNV       240
     VTVFHGPGSH ELDLPSSAEV NKVMEAISKS TLERSNWYKA TFYGISIEKR STFDITSLEF       300
     DKFRVSFMER PEFGIDDLPS SLWKYMLSSN NYLIDCHNSF LVKEYDNHEI NSLKEFIMDQ       360
     RGIKSTRKLL VGYAEGKLAK TCEGLCDSRI RVFTFDDRVK RVSIVYIYAN NSTKELNNAI       420
     SSAVRQIVDK VILVTPDDHS CTGISLGITY SPATFCEDIV NKASELIKRS TENMKEINSI       480
     EYKVVKIKGV KILGKIISIM LKALEDVGSY TSKTFWIPLV APYVLLVVIL LFQSLIKF         538
//

If you have problems or comments...

PBIL Back to PBIL home page