(data stored in ACNUC7421 zone)

EMBL: CP001402.PE17

CP001402.PE17        Location/Qualifiers
FT   CDS             complement(14721..16334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0017"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40653"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD3"
FT                   /protein_id="ACR40653.1"
FT                   /translation="MLMEKGEIIGIVLQKSEANELQGLIRADEEINIGQLLLIDDSEKL
FT                   SLVRVENYEFLNEFFDERGDIAKSILKEPSIYEILDMNTIIKATLHLIKKYDHSTTPKP
FT                   GSFVRKLPEIKSEKDLLSFYGIKSKKGLIEYGALAGSEIPLLLDLNAITMHVGVFGETG
FT                   SGKSYNMRYLIKLLSNIKIGDNITALPMIVIDANGDYIDLASTNLDIVSRGRGWIKRYI
FT                   LKDPKEQNDIKLTIDLSIFTPRELSEFIMSLKYGEASYNTLQLNFLEQVLANHDSKEYN
FT                   TLLGTAIGIENLRNEILTMAQNKDIGITTSTARGIASALEIFKNKVISRLQLVNSSASL
FT                   TENTLEVIWRNRGLAIIDFSAEGSPGIDVLTKQLIVSYITRLIFNYLTKSKYNGNQRFL
FT                   GFVIEEAQNYIPSVDYPVNANLTKDVLVTLATQGRKFGASLILVSQRPAFIDKYVLSMI
FT                   NTFFFHRIYHEDVRYVMSASGGLPESLTRNLTSLETGHVIVSGLMSIMKSPALVRIPWD
FT                   ARLGSYAGNVERIDLILSEG"
     MLMEKGEIIG IVLQKSEANE LQGLIRADEE INIGQLLLID DSEKLSLVRV ENYEFLNEFF        60
     DERGDIAKSI LKEPSIYEIL DMNTIIKATL HLIKKYDHST TPKPGSFVRK LPEIKSEKDL       120
     LSFYGIKSKK GLIEYGALAG SEIPLLLDLN AITMHVGVFG ETGSGKSYNM RYLIKLLSNI       180
     KIGDNITALP MIVIDANGDY IDLASTNLDI VSRGRGWIKR YILKDPKEQN DIKLTIDLSI       240
     FTPRELSEFI MSLKYGEASY NTLQLNFLEQ VLANHDSKEY NTLLGTAIGI ENLRNEILTM       300
     AQNKDIGITT STARGIASAL EIFKNKVISR LQLVNSSASL TENTLEVIWR NRGLAIIDFS       360
     AEGSPGIDVL TKQLIVSYIT RLIFNYLTKS KYNGNQRFLG FVIEEAQNYI PSVDYPVNAN       420
     LTKDVLVTLA TQGRKFGASL ILVSQRPAFI DKYVLSMINT FFFHRIYHED VRYVMSASGG       480
     LPESLTRNLT SLETGHVIVS GLMSIMKSPA LVRIPWDARL GSYAGNVERI DLILSEG          537
//

If you have problems or comments...

PBIL Back to PBIL home page