(data stored in ACNUC7421 zone)

EMBL: CP001402.PE172

CP001402.PE172       Location/Qualifiers
FT   CDS             147375..149075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0174"
FT                   /product="succinate dehydrogenase or fumarate
FT                   reductase,flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40808"
FT                   /db_xref="GOA:C4KK67"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK67"
FT                   /protein_id="ACR40808.1"
FT                   /translation="MEKIEYDAVVIGGGLAGLMSAHEIASAGFKVAVISKVFPTRSHSA
FT                   AAEGGIAAYIPGNSDPNDNPDYMTYDTVKGGDYLVDQDAAELLSNKSGEIVMLLERWGA
FT                   LFNRQPDGRVAVRYFGGQTYPRTRFVGDKTGMALLHTLFERTSGLNVDFYNEWFSLDLV
FT                   TDNKKVVGIVAMQMKTLTPFFFKTKAVVLATGGMGMLYRHTTNSYINTGDGFGIALRAG
FT                   AALKDPEFVQFHPTALYPSDVLISEAARGEGGILKNVKGERFMTKYAPKKLDLAPRDIV
FT                   SRAIITEIREGRGFPGGYVGLDLTHLGEEYIKERLALAVEAAKSFASVDAFTEPIPVRP
FT                   AQHYYMGGIDVDIDGRNPDIVGLFSAGEAACVSVHGANRLGSNSLLDTLVFGQVTGRTV
FT                   VQFLKSNPGNPTSNYEKEAEKVVDDAYKFVKSESGVHFGQILEKLRDTMWDYVGIYRDE
FT                   GGLLNAMSEINKLRGMISNMYVTDKSKVYNTEFFNALELRNMLDLALTITKSALERKES
FT                   RGAHYRTDYPDRDDNNWLKHTIAYLRGNTVEVTFKPVKITRWKPEPRVY"
     MEKIEYDAVV IGGGLAGLMS AHEIASAGFK VAVISKVFPT RSHSAAAEGG IAAYIPGNSD        60
     PNDNPDYMTY DTVKGGDYLV DQDAAELLSN KSGEIVMLLE RWGALFNRQP DGRVAVRYFG       120
     GQTYPRTRFV GDKTGMALLH TLFERTSGLN VDFYNEWFSL DLVTDNKKVV GIVAMQMKTL       180
     TPFFFKTKAV VLATGGMGML YRHTTNSYIN TGDGFGIALR AGAALKDPEF VQFHPTALYP       240
     SDVLISEAAR GEGGILKNVK GERFMTKYAP KKLDLAPRDI VSRAIITEIR EGRGFPGGYV       300
     GLDLTHLGEE YIKERLALAV EAAKSFASVD AFTEPIPVRP AQHYYMGGID VDIDGRNPDI       360
     VGLFSAGEAA CVSVHGANRL GSNSLLDTLV FGQVTGRTVV QFLKSNPGNP TSNYEKEAEK       420
     VVDDAYKFVK SESGVHFGQI LEKLRDTMWD YVGIYRDEGG LLNAMSEINK LRGMISNMYV       480
     TDKSKVYNTE FFNALELRNM LDLALTITKS ALERKESRGA HYRTDYPDRD DNNWLKHTIA       540
     YLRGNTVEVT FKPVKITRWK PEPRVY                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page