(data stored in ACNUC7421 zone)

EMBL: CP001402.PE173

CP001402.PE173       Location/Qualifiers
FT   CDS             149077..150027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0175"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40809"
FT                   /db_xref="GOA:C4KK68"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK68"
FT                   /protein_id="ACR40809.1"
FT                   /translation="MTQSQEEEVILKVKRFNPERGFWWAEYKLKVDRFTQFTEALRRIK
FT                   SEQDPTLSYRASCHMAVCGSCGMKINGEPRLACKTLVLDVAKKYNSHVITIEPMDYFKP
FT                   IKDLIVDWDEFYERMFKVKPRLYQAKEVLEGKAEHRLKPEDQKELWKFAQCIWCGLCVS
FT                   ACPAVIIDQQFLGPAAHAKGYRFLADPRDTITEERMKILIDSSWRCTYCYQCFNVCPRD
FT                   IEPVTAIKKTRSFTRMYKAKSEVAERGENHVEAIRESIFKTGKLSEAPVYLKTYGVLQS
FT                   LIDLVYMSRAGKLKYILVQEKPVQNINEIKKIIGE"
     MTQSQEEEVI LKVKRFNPER GFWWAEYKLK VDRFTQFTEA LRRIKSEQDP TLSYRASCHM        60
     AVCGSCGMKI NGEPRLACKT LVLDVAKKYN SHVITIEPMD YFKPIKDLIV DWDEFYERMF       120
     KVKPRLYQAK EVLEGKAEHR LKPEDQKELW KFAQCIWCGL CVSACPAVII DQQFLGPAAH       180
     AKGYRFLADP RDTITEERMK ILIDSSWRCT YCYQCFNVCP RDIEPVTAIK KTRSFTRMYK       240
     AKSEVAERGE NHVEAIRESI FKTGKLSEAP VYLKTYGVLQ SLIDLVYMSR AGKLKYILVQ       300
     EKPVQNINEI KKIIGE                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page