(data stored in ACNUC7421 zone)

EMBL: CP001402.PE175

CP001402.PE175       Location/Qualifiers
FT   CDS             150906..151271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0177"
FT                   /product="succinate dehydrogenase subunit D (SdhD)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40811"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK70"
FT                   /protein_id="ACR40811.1"
FT                   /translation="MSEEIKKIIQDVGGKPEEWISVSERPGKEPFAKELNYIFNDYFWG
FT                   KVHVRNEGDIYVLVISKDVFNWKDRIKDLKLSGEVVDAAGGLMWIQEFDIQGLKRDFAS
FT                   LKTFIENIRKQKQQKTS"
     MSEEIKKIIQ DVGGKPEEWI SVSERPGKEP FAKELNYIFN DYFWGKVHVR NEGDIYVLVI        60
     SKDVFNWKDR IKDLKLSGEV VDAAGGLMWI QEFDIQGLKR DFASLKTFIE NIRKQKQQKT       120
     S                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page