(data stored in ACNUC7421 zone)

EMBL: CP001402.PE179

CP001402.PE179       Location/Qualifiers
FT   CDS             154737..155018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40815"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK74"
FT                   /protein_id="ACR40815.1"
FT                   /translation="MNFEDVKDKKPKKIGELIDRSEENENYIVKVAEDKVYELAPIAYY
FT                   IWTMCDGNKSVDEIVNELSKEANLDISQVRDPVVMVLDELEKASLIAF"
     MNFEDVKDKK PKKIGELIDR SEENENYIVK VAEDKVYELA PIAYYIWTMC DGNKSVDEIV        60
     NELSKEANLD ISQVRDPVVM VLDELEKASL IAF                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page