(data stored in ACNUC7421 zone)

EMBL: CP001402.PE18

CP001402.PE18        Location/Qualifiers
FT   CDS             complement(16379..16945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40654"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD4"
FT                   /protein_id="ACR40654.1"
FT                   /translation="MSSACERLYEYLKPDFTRISKKDNTDDLFRHPVVMRWHHYFLENW
FT                   NSDKEIGLLLPCTVVKPYSLSPTHKIAYATLNKYNLEEKVQVYSVSEPMLLVPKELEEC
FT                   YPFNNYDYPPRLMSKEEKEEFIMLLTKPLIKVSMLHNRLIGILPRHHYEIVKRAAEISN
FT                   LKITIYPYGRLAFKTIANVITSISS"
     MSSACERLYE YLKPDFTRIS KKDNTDDLFR HPVVMRWHHY FLENWNSDKE IGLLLPCTVV        60
     KPYSLSPTHK IAYATLNKYN LEEKVQVYSV SEPMLLVPKE LEECYPFNNY DYPPRLMSKE       120
     EKEEFIMLLT KPLIKVSMLH NRLIGILPRH HYEIVKRAAE ISNLKITIYP YGRLAFKTIA       180
     NVITSISS                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page