(data stored in ACNUC7421 zone)

EMBL: CP001402.PE180

CP001402.PE180       Location/Qualifiers
FT   CDS             155043..156683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0182"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40816"
FT                   /db_xref="GOA:C4KK75"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK75"
FT                   /protein_id="ACR40816.1"
FT                   /translation="MRVFVGDESLYSIDEAIKVYLSSLNFTPKIVKVEVKDSFGYVSAE
FT                   DLMSPIDYPPFSRSNVDGYALKSSCTPGELKVIDRIGIGEFKEIHIKECVAVEVDTGAM
FT                   IPMGADAVIKVENVKLINGNFIKIDKKINFGQNIGWIGSDIPKNSIILRKGEVISHEKI
FT                   GLLASLGISSIKVYEKLKIYLIATGDELVEPGNSLSPGKIYESNLHYLYSKLKENYKIV
FT                   GLSLLSDDIRSIKNEIKRAISVADVLILTGGTSAGEKDFVHRAIRELGNIIVHGIKIKP
FT                   GKPTILGIVDGKPVIGLPGNIVSSMVVLNMVILEILKSLYPSRKEILGLGKIKARLALR
FT                   VKADEHRNTLIPVYLFRSIDNSYYALPVKFDSYMVGTFSLTEGYIMLGPNEEIEEGKEV
FT                   EVDVKKFDDSISIIGEEDKRILNLDTKNVLLGSLPASKAIEYKFGDVAVISSLFTEPIE
FT                   NYDKVLCRQILVNGEGEEIGYDDWIGMSKIVKNPVVKLKSPSTIYSLVGKARVYAPEGY
FT                   IVGDKVAEECLYMIGISERGKRYLSTIKV"
     MRVFVGDESL YSIDEAIKVY LSSLNFTPKI VKVEVKDSFG YVSAEDLMSP IDYPPFSRSN        60
     VDGYALKSSC TPGELKVIDR IGIGEFKEIH IKECVAVEVD TGAMIPMGAD AVIKVENVKL       120
     INGNFIKIDK KINFGQNIGW IGSDIPKNSI ILRKGEVISH EKIGLLASLG ISSIKVYEKL       180
     KIYLIATGDE LVEPGNSLSP GKIYESNLHY LYSKLKENYK IVGLSLLSDD IRSIKNEIKR       240
     AISVADVLIL TGGTSAGEKD FVHRAIRELG NIIVHGIKIK PGKPTILGIV DGKPVIGLPG       300
     NIVSSMVVLN MVILEILKSL YPSRKEILGL GKIKARLALR VKADEHRNTL IPVYLFRSID       360
     NSYYALPVKF DSYMVGTFSL TEGYIMLGPN EEIEEGKEVE VDVKKFDDSI SIIGEEDKRI       420
     LNLDTKNVLL GSLPASKAIE YKFGDVAVIS SLFTEPIENY DKVLCRQILV NGEGEEIGYD       480
     DWIGMSKIVK NPVVKLKSPS TIYSLVGKAR VYAPEGYIVG DKVAEECLYM IGISERGKRY       540
     LSTIKV                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page