(data stored in ACNUC7421 zone)

EMBL: CP001402.PE181

CP001402.PE181       Location/Qualifiers
FT   CDS             157022..157957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0183"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40817"
FT                   /db_xref="GOA:C4KK76"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KK76"
FT                   /protein_id="ACR40817.1"
FT                   /translation="MECKRARAYSSSANLGSGFDILSMAHTAFFDTVEICVETKNSENI
FT                   VIESNSKIPLEPNRNSATYPLVRIMEERGIKASLRVKVIKGIPEGLGLGSSGASATAAV
FT                   MAFSSLFNLNLSKEDLVRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVNPVKVVEIP
FT                   LNYSFNILLFVPLNVHIEEKTKKAREMVPKTVKLSDYINNSRYISSLLIGFVKGERDLI
FT                   RLGLNDEIVEKARLPLFPYYPKIKEIAIKYDAVGSCVSGAGPSILVLTDKMTDENKIAE
FT                   EGTKTCNEFNVECEVIKAKIAGGVEVERRN"
     MECKRARAYS SSANLGSGFD ILSMAHTAFF DTVEICVETK NSENIVIESN SKIPLEPNRN        60
     SATYPLVRIM EERGIKASLR VKVIKGIPEG LGLGSSGASA TAAVMAFSSL FNLNLSKEDL       120
     VRYAMYGEIA SSGSPHPDNV AASVFGGVVS VVSVNPVKVV EIPLNYSFNI LLFVPLNVHI       180
     EEKTKKAREM VPKTVKLSDY INNSRYISSL LIGFVKGERD LIRLGLNDEI VEKARLPLFP       240
     YYPKIKEIAI KYDAVGSCVS GAGPSILVLT DKMTDENKIA EEGTKTCNEF NVECEVIKAK       300
     IAGGVEVERR N                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page