(data stored in ACNUC7421 zone)

EMBL: CP001402.PE184

CP001402.PE184       Location/Qualifiers
FT   CDS             complement(159361..159900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40820"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK79"
FT                   /protein_id="ACR40820.1"
FT                   /translation="MSTEIDSKNVSMDMFTTYEEELRVGEALAHILAAASIVIELEGES
FT                   EEVRNTIMKYVDLWISKLSPIDYSPGMAEVIGSKVRKKITNIFDEISENELGDILDFII
FT                   DVKRKLDIGTLETEILELEVRVERVLRVLGIDINDIRQFFDFTNVEKRANRLIALATVS
FT                   IGIASVWDEKWTAELQ"
     MSTEIDSKNV SMDMFTTYEE ELRVGEALAH ILAAASIVIE LEGESEEVRN TIMKYVDLWI        60
     SKLSPIDYSP GMAEVIGSKV RKKITNIFDE ISENELGDIL DFIIDVKRKL DIGTLETEIL       120
     ELEVRVERVL RVLGIDINDI RQFFDFTNVE KRANRLIALA TVSIGIASVW DEKWTAELQ        179
//

If you have problems or comments...

PBIL Back to PBIL home page