(data stored in ACNUC7421 zone)

EMBL: CP001402.PE185

CP001402.PE185       Location/Qualifiers
FT   CDS             160038..161045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0187"
FT                   /product="protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40821"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK80"
FT                   /protein_id="ACR40821.1"
FT                   /translation="MKAFVFGIGGGGDIVSAIVAYTYLRKLGYNVLLGAVVWERYVEDP
FT                   IPGPICFDDLRNAILVNQGLYKVNKDTYAIRGSRQVVPQLVRAIRALELDGAYGICNKS
FT                   GAMGLYSSLKEFVNTEKIDLIVGVDAGGDVLAKGCEETLGSPLIDFISLASLVKLEEDG
FT                   YNVMLGVIGSGSDGELQYDYFLKRISEIASLNGLLDIKGYDRETATLVERVLNEVNTEA
FT                   SKIPFEAFKGLYGEIPIRNGTRNVFVTPVSAIMFFLDPIKVAETSPLYSLVKDSSSIDD
FT                   ANKNLNEVGIYTEYNFEIDLYSQFGLNASHASAYDVSKIRAEGRRKLGGVKIKC"
     MKAFVFGIGG GGDIVSAIVA YTYLRKLGYN VLLGAVVWER YVEDPIPGPI CFDDLRNAIL        60
     VNQGLYKVNK DTYAIRGSRQ VVPQLVRAIR ALELDGAYGI CNKSGAMGLY SSLKEFVNTE       120
     KIDLIVGVDA GGDVLAKGCE ETLGSPLIDF ISLASLVKLE EDGYNVMLGV IGSGSDGELQ       180
     YDYFLKRISE IASLNGLLDI KGYDRETATL VERVLNEVNT EASKIPFEAF KGLYGEIPIR       240
     NGTRNVFVTP VSAIMFFLDP IKVAETSPLY SLVKDSSSID DANKNLNEVG IYTEYNFEID       300
     LYSQFGLNAS HASAYDVSKI RAEGRRKLGG VKIKC                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page