(data stored in ACNUC7421 zone)

EMBL: CP001402.PE186

CP001402.PE186       Location/Qualifiers
FT   CDS             161076..161618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK81"
FT                   /protein_id="ACR40822.1"
FT                   /translation="MDLIRELKSEYGFDEDEINYALSRARGIIFGFAMEYRARRILQEM
FT                   DFENIKSVDMPTHDIEAEKNGIKYYVEVKASKKSPTREYSAYKVAMIALLDGVHLTLSM
FT                   IPKPNLLLTEEILSEPKRILYRFFKLAYMKQSEELKVFLENEKNREVLDSYSNVIRTIS
FT                   NRYHLPIALDLVNPFSS"
     MDLIRELKSE YGFDEDEINY ALSRARGIIF GFAMEYRARR ILQEMDFENI KSVDMPTHDI        60
     EAEKNGIKYY VEVKASKKSP TREYSAYKVA MIALLDGVHL TLSMIPKPNL LLTEEILSEP       120
     KRILYRFFKL AYMKQSEELK VFLENEKNRE VLDSYSNVIR TISNRYHLPI ALDLVNPFSS       180
//

If you have problems or comments...

PBIL Back to PBIL home page