(data stored in ACNUC7421 zone)

EMBL: CP001402.PE19

CP001402.PE19        Location/Qualifiers
FT   CDS             complement(16917..17801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40655"
FT                   /db_xref="GOA:C4KJD5"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD5"
FT                   /protein_id="ACR40655.1"
FT                   /translation="MKIILGIPDLKIPVWTFKQPLMVNQLNWNNLSWENETWVDSGGYQ
FT                   IMVKGIKVEIEKVVEKYKILDATQYMSLDIPSNPCHKPSELNYKYFEYLYAVFDKKIVP
FT                   VIHAYDVESIKKSIDFYSQYTDLVAFGGIIPPTLNKSGNKKLAVTIYHLVRKLWKGKIH
FT                   VLGAGSPFMRKVYFNANSVDTSTYRIKGIHGMVIIPGKGERYVGERKIVWGTRRASEEE
FT                   LETLLSFLDRTNYPFPIRLDNWVDRSLINAWVLLNSEYEINNPLIEYSKKLDSFPEDEI
FT                   EEEVNELCMRATI"
     MKIILGIPDL KIPVWTFKQP LMVNQLNWNN LSWENETWVD SGGYQIMVKG IKVEIEKVVE        60
     KYKILDATQY MSLDIPSNPC HKPSELNYKY FEYLYAVFDK KIVPVIHAYD VESIKKSIDF       120
     YSQYTDLVAF GGIIPPTLNK SGNKKLAVTI YHLVRKLWKG KIHVLGAGSP FMRKVYFNAN       180
     SVDTSTYRIK GIHGMVIIPG KGERYVGERK IVWGTRRASE EELETLLSFL DRTNYPFPIR       240
     LDNWVDRSLI NAWVLLNSEY EINNPLIEYS KKLDSFPEDE IEEEVNELCM RATI             294
//

If you have problems or comments...

PBIL Back to PBIL home page