(data stored in ACNUC7421 zone)

EMBL: CP001402.PE191

CP001402.PE191       Location/Qualifiers
FT   CDS             complement(164514..165779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0193"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40827"
FT                   /db_xref="GOA:C4KK86"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK86"
FT                   /protein_id="ACR40827.1"
FT                   /translation="MKTIYVETYGCALNRADTYVMMTLLKSEGYNFVENPENADIIILN
FT                   TCAVRLETEERMKQRIKELNTLSKKLVVAGCMSSAEPATVLSIAPNASLIGPQSVERII
FT                   DVIKSEERKIVLEGDRALITPRTFDGKIAIIPVADGCAGNCSFCITKLARRKLRSYPLR
FT                   EIVNAARDAVKAGAKEIELTGQDTAAYGLDLGGSISLVDVVNKVTEIDGDFMIRIGMMT
FT                   PEQAMRIIDNLIEVMRNPKVYKFIHLPVQSGDDRVLKLMNRKYTIDEYKELVSEIRSKI
FT                   PFANITTDIIIGHPGEDEDAFNNTLLLMKELRFERIHLAMYSIRPNTRSASMPQVPDSV
FT                   KKKRIQIANKLYEDIALSIHLEYVGSTSRVITTELGRKGSVVGRLMNYIPVVIRSENVE
FT                   LGKWYNVKITEASFYDLRGVFA"
     MKTIYVETYG CALNRADTYV MMTLLKSEGY NFVENPENAD IIILNTCAVR LETEERMKQR        60
     IKELNTLSKK LVVAGCMSSA EPATVLSIAP NASLIGPQSV ERIIDVIKSE ERKIVLEGDR       120
     ALITPRTFDG KIAIIPVADG CAGNCSFCIT KLARRKLRSY PLREIVNAAR DAVKAGAKEI       180
     ELTGQDTAAY GLDLGGSISL VDVVNKVTEI DGDFMIRIGM MTPEQAMRII DNLIEVMRNP       240
     KVYKFIHLPV QSGDDRVLKL MNRKYTIDEY KELVSEIRSK IPFANITTDI IIGHPGEDED       300
     AFNNTLLLMK ELRFERIHLA MYSIRPNTRS ASMPQVPDSV KKKRIQIANK LYEDIALSIH       360
     LEYVGSTSRV ITTELGRKGS VVGRLMNYIP VVIRSENVEL GKWYNVKITE ASFYDLRGVF       420
     A                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page