(data stored in ACNUC7421 zone)

EMBL: CP001402.PE194

CP001402.PE194       Location/Qualifiers
FT   CDS             166542..167255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0196"
FT                   /product="NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40830"
FT                   /db_xref="GOA:C4KK89"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK89"
FT                   /protein_id="ACR40830.1"
FT                   /translation="MSGKFCVLCGKQNVELIDSLCADCYVKSKKLIEVPKRITGKYCKI
FT                   CGAQWIKGKWIRTSATSLASVVEDIIIREVGNKIDIDKNVEEFAFDIKSIWKDPSGNSF
FT                   ATIEFRGNVRGKPFSQEAIISLEMERTLCDSCFRKKTRYYEAIVQLRSKGKIGIDDKKR
FT                   AFFESFFSTSIVDNISDVIEGREGVDYYFMSKSVARKLISMISSIVDVEVNESYQNEKM
FT                   KNGKREAKLVISLRI"
     MSGKFCVLCG KQNVELIDSL CADCYVKSKK LIEVPKRITG KYCKICGAQW IKGKWIRTSA        60
     TSLASVVEDI IIREVGNKID IDKNVEEFAF DIKSIWKDPS GNSFATIEFR GNVRGKPFSQ       120
     EAIISLEMER TLCDSCFRKK TRYYEAIVQL RSKGKIGIDD KKRAFFESFF STSIVDNISD       180
     VIEGREGVDY YFMSKSVARK LISMISSIVD VEVNESYQNE KMKNGKREAK LVISLRI          237
//

If you have problems or comments...

PBIL Back to PBIL home page