(data stored in ACNUC7421 zone)

EMBL: CP001402.PE196

CP001402.PE196       Location/Qualifiers
FT   CDS             167884..168939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0198"
FT                   /product="TGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40832"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK91"
FT                   /protein_id="ACR40832.1"
FT                   /translation="MVTNLPAEAKAKWLKVMDARTPEEKFQALQEFLKEVPKHKGTENL
FT                   VYWAKRRMAELREEMEVRKSKKSGGFSLFVEKEGAGQAILIGDLLLRSLIMKKLTNVKQ
FT                   EFNELPVPGMVKYEDVQIQLVNPPKSLPLTKTIGLIRNADEVIIVVNNKEELSFMRNIL
FT                   EENNILLRKPKGRVIIERTRYGISGIRIVNLGKLVDVDEKAVRDYIESFGIKSAIVKII
FT                   GEVALDDIEKSMFEAVSYKPTVVISKERFDTGELPILSIDHLDKLPKLLFEMLEVIRIY
FT                   TKEPGEESTKDPLILKKGSTVLDVARKLHSSLAENFRYARVWGRSVKFQGQKVGPSHVL
FT                   EDKDIVEIHAK"
     MVTNLPAEAK AKWLKVMDAR TPEEKFQALQ EFLKEVPKHK GTENLVYWAK RRMAELREEM        60
     EVRKSKKSGG FSLFVEKEGA GQAILIGDLL LRSLIMKKLT NVKQEFNELP VPGMVKYEDV       120
     QIQLVNPPKS LPLTKTIGLI RNADEVIIVV NNKEELSFMR NILEENNILL RKPKGRVIIE       180
     RTRYGISGIR IVNLGKLVDV DEKAVRDYIE SFGIKSAIVK IIGEVALDDI EKSMFEAVSY       240
     KPTVVISKER FDTGELPILS IDHLDKLPKL LFEMLEVIRI YTKEPGEEST KDPLILKKGS       300
     TVLDVARKLH SSLAENFRYA RVWGRSVKFQ GQKVGPSHVL EDKDIVEIHA K                351
//

If you have problems or comments...

PBIL Back to PBIL home page