(data stored in ACNUC7421 zone)

EMBL: CP001402.PE197

CP001402.PE197       Location/Qualifiers
FT   CDS             168991..170841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0199"
FT                   /product="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40833"
FT                   /db_xref="GOA:C4KK92"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK92"
FT                   /protein_id="ACR40833.1"
FT                   /translation="MSIFNKRNNKQAVNNQGPSKIELLFYNSSLINSLVKSVDIKMKKA
FT                   GINQDPRLFASRLFLTLIFSIAISVMLVVFAVRFFEIYKLTLLTKYLAGFLTMMIFGII
FT                   IPPVVYLMQILQLSQLTENRRIGLDSEAPAFAAVFNVFLRSGLSARYVFDYLSKSTAMQ
FT                   YASQIASYVNKRVKYLGEGVESAIVESLNYSPSKIFNEFLTTYVTAVRTGAPVLDTMEA
FT                   KTKDILKNIETLASTAAENLSGIAEGFVIWLSSGFITFFLVLLLQAIFPSLFGSVPFPI
FT                   MAIFAMIMIPLINLLFIWVVDQIQFRFPERSLKAYKIFYVTFPIGLVVSFIILYLIKEP
FT                   IPLLLNLLFLNAGVQQIPLSVLAFTIGLLIAVIPPAVIAVRELREGTGYDVYVVSFLRA
FT                   VAEGLRAGLNPATVVRNLKDSPEMGKFRDILNTIYAYSLLGVPIKDAFRIASERILDFS
FT                   SKVSLISLADMIEIGSLTPETVESLAEQVDAQIRIRRNYNAKIRVLLYAPYIGIILALV
FT                   ASILLGNAMFTLISHQSYSLSYGPLSNAAVILPKSLYIISISALFNSFLAGLLVGKIGY
FT                   GKTAAGFIHSAILVVITAILVVISLHISLIPSISPSSTSL"
     MSIFNKRNNK QAVNNQGPSK IELLFYNSSL INSLVKSVDI KMKKAGINQD PRLFASRLFL        60
     TLIFSIAISV MLVVFAVRFF EIYKLTLLTK YLAGFLTMMI FGIIIPPVVY LMQILQLSQL       120
     TENRRIGLDS EAPAFAAVFN VFLRSGLSAR YVFDYLSKST AMQYASQIAS YVNKRVKYLG       180
     EGVESAIVES LNYSPSKIFN EFLTTYVTAV RTGAPVLDTM EAKTKDILKN IETLASTAAE       240
     NLSGIAEGFV IWLSSGFITF FLVLLLQAIF PSLFGSVPFP IMAIFAMIMI PLINLLFIWV       300
     VDQIQFRFPE RSLKAYKIFY VTFPIGLVVS FIILYLIKEP IPLLLNLLFL NAGVQQIPLS       360
     VLAFTIGLLI AVIPPAVIAV RELREGTGYD VYVVSFLRAV AEGLRAGLNP ATVVRNLKDS       420
     PEMGKFRDIL NTIYAYSLLG VPIKDAFRIA SERILDFSSK VSLISLADMI EIGSLTPETV       480
     ESLAEQVDAQ IRIRRNYNAK IRVLLYAPYI GIILALVASI LLGNAMFTLI SHQSYSLSYG       540
     PLSNAAVILP KSLYIISISA LFNSFLAGLL VGKIGYGKTA AGFIHSAILV VITAILVVIS       600
     LHISLIPSIS PSSTSL                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page