(data stored in ACNUC7421 zone)

EMBL: CP001402.PE198

CP001402.PE198       Location/Qualifiers
FT   CDS             170865..172598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0200"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40834"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK93"
FT                   /protein_id="ACR40834.1"
FT                   /translation="MSKVFKSLLPKGKPNVKQLPITELPITLYPVSPFPEEVTTIAADY
FT                   EVNILSLAPEDVKSNITRNNIELVLPNPHIFVTFDERKGIYKYVLLEPPVNDTIYNMYN
FT                   IFIEEIERELLSKTPSLDLAKIIFELNKKRSDLNIIQEKRGDIYILTTNARVTLYYLLR
FT                   NMFGYNVLTSLVADKNIEDISVSGLNNPVYVYHRSYEYIPTNIMFTKNMKISPQLNIMI
FT                   DGEELLDQLVLRMLSTTGKSISVAEPIQDGMLPNGDRIAATFRREVSASGSSVVIRRFS
FT                   ERPITILDLINSGTLSPELAAYLWYGMDLRMSVMSIGVTGAGKTTLLNAVLNLVKESMK
FT                   IVSIEDIPEIRLAHTNWVQLYARPAYAGVGKEISLMDLLKLSLRYRPDIIVVGEIRGQE
FT                   AYVLFQAISTGHGGATTFHAYNTDSAIKRLMNEPLNIPQEWIPMMNIMMTIRRLPVYVG
FT                   EKIVLRRRVVAVDEIVSWNDYRRVSSWDPKGDVFTINLDSARVLRNRIEEAGLNIDDVK
FT                   REMERRALFLKLLASSREIIQSEESYKLVKKYIIKYSLKPEEALKEVQTMAGVKTIELK
FT                   E"
     MSKVFKSLLP KGKPNVKQLP ITELPITLYP VSPFPEEVTT IAADYEVNIL SLAPEDVKSN        60
     ITRNNIELVL PNPHIFVTFD ERKGIYKYVL LEPPVNDTIY NMYNIFIEEI ERELLSKTPS       120
     LDLAKIIFEL NKKRSDLNII QEKRGDIYIL TTNARVTLYY LLRNMFGYNV LTSLVADKNI       180
     EDISVSGLNN PVYVYHRSYE YIPTNIMFTK NMKISPQLNI MIDGEELLDQ LVLRMLSTTG       240
     KSISVAEPIQ DGMLPNGDRI AATFRREVSA SGSSVVIRRF SERPITILDL INSGTLSPEL       300
     AAYLWYGMDL RMSVMSIGVT GAGKTTLLNA VLNLVKESMK IVSIEDIPEI RLAHTNWVQL       360
     YARPAYAGVG KEISLMDLLK LSLRYRPDII VVGEIRGQEA YVLFQAISTG HGGATTFHAY       420
     NTDSAIKRLM NEPLNIPQEW IPMMNIMMTI RRLPVYVGEK IVLRRRVVAV DEIVSWNDYR       480
     RVSSWDPKGD VFTINLDSAR VLRNRIEEAG LNIDDVKREM ERRALFLKLL ASSREIIQSE       540
     ESYKLVKKYI IKYSLKPEEA LKEVQTMAGV KTIELKE                                577
//

If you have problems or comments...

PBIL Back to PBIL home page