(data stored in ACNUC7421 zone)

EMBL: CP001402.PE2

CP001402.PE2         Location/Qualifiers
FT   CDS             842..2029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0002"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40638"
FT                   /db_xref="GOA:C4KJB8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJB8"
FT                   /protein_id="ACR40638.1"
FT                   /translation="MNVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIA
FT                   IRYFVKNEVKFSNLFLGLTGTGKTFVSKYIYNEIEEVKNEDEEYKDVKQAYVNCREVGG
FT                   TPQAVLSSLAGKLTGFSVPKHGINLGEYIDKIKNGTRNIKAIIYLDEVDTLVKRRGGDI
FT                   VLYQLLRSDANISVIMISNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEY
FT                   GLIKGTYDGDILGYIAAISAKEHGDARKAVNLLFRAAQLASGGGMIKKEHVDKAIVDYE
FT                   QERLIEAVKALPFHYKLALRSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISEL
FT                   DMFGIVKIRIVNRGRAGGVKKYALVEDKEKVLRALNETFEDSIGIGDFVDDVGEN"
     MNVIRETLKG GKGEVIKNPK VFIDPLSVFK EIPFREDILR DAAIAIRYFV KNEVKFSNLF        60
     LGLTGTGKTF VSKYIYNEIE EVKNEDEEYK DVKQAYVNCR EVGGTPQAVL SSLAGKLTGF       120
     SVPKHGINLG EYIDKIKNGT RNIKAIIYLD EVDTLVKRRG GDIVLYQLLR SDANISVIMI       180
     SNDINVRDYM EPRVLSSLGP SVIFKPYDAE QLKFILSKYA EYGLIKGTYD GDILGYIAAI       240
     SAKEHGDARK AVNLLFRAAQ LASGGGMIKK EHVDKAIVDY EQERLIEAVK ALPFHYKLAL       300
     RSLIESEDVM SAHKMYTDLC NKFKQKPLSY RRFSDIISEL DMFGIVKIRI VNRGRAGGVK       360
     KYALVEDKEK VLRALNETFE DSIGIGDFVD DVGEN                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page