(data stored in ACNUC7421 zone)

EMBL: CP001402.PE20

CP001402.PE20        Location/Qualifiers
FT   CDS             18044..18724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40656"
FT                   /db_xref="GOA:C4KJD6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD6"
FT                   /protein_id="ACR40656.1"
FT                   /translation="MSKGAEILILFTVFVFTLNIISNAYVVNVKILSPFPVTLLFSDSH
FT                   GVKLVSSNQTLNVNSSNLRIQAFVLAPYSYSILINGNNTNELNVNLSNYSEFNLTVIVI
FT                   PSYAFLKVDVVGKGTVYIELNNGTIIAVRNSSVVKLYNGSNVLLEASGDLLNWSNGGNT
FT                   MTIWYSVNGNSTITAFFGNSSILLKSGTVKPIVNYTEVGLSLFAIGFFVLYKIYSRKDQ
FT                   DTNV"
     MSKGAEILIL FTVFVFTLNI ISNAYVVNVK ILSPFPVTLL FSDSHGVKLV SSNQTLNVNS        60
     SNLRIQAFVL APYSYSILIN GNNTNELNVN LSNYSEFNLT VIVIPSYAFL KVDVVGKGTV       120
     YIELNNGTII AVRNSSVVKL YNGSNVLLEA SGDLLNWSNG GNTMTIWYSV NGNSTITAFF       180
     GNSSILLKSG TVKPIVNYTE VGLSLFAIGF FVLYKIYSRK DQDTNV                      226
//

If you have problems or comments...

PBIL Back to PBIL home page