(data stored in ACNUC7421 zone)

EMBL: CP001402.PE202

CP001402.PE202       Location/Qualifiers
FT   CDS             complement(174959..176329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0204"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40838"
FT                   /db_xref="GOA:C4KK97"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK97"
FT                   /protein_id="ACR40838.1"
FT                   /translation="MGSSWKYESEKAMIKPVGMTVAGLDTGNGAGGETDLRVFEVLGIH
FT                   GVFAITAITAQSTRGIKDINVVSSEFLKKQIETLLDDFNVEAVKMGMIYTKEQFQVVNE
FT                   LLHDSFLVVDPVLYAKDGTPLIKDVEDYKKIILPIAKVITPNIIEASAISGIKVEKESD
FT                   VVIACKKIRETYNIAHVIIKGGHSKGDFSFDYMCNEEGVYKIGYHKIQAKDTHGTGSVF
FT                   ATAFTAEYIKTKDVKLAFRKARDFVQSPIEYGLNIGKGVGPVNVSIEIMKKSMKYEVVE
FT                   EMRRFADFAENNEKFWILIPEVQSNLAHSIKPEYVRDLNDIATFRGRIIRRWDKKVIVG
FT                   HPVVFGNPTHTARMLLSIILKGMNSTCLMNIRYDDKIVESFKEIGYETVEINRELEPSH
FT                   GEGKTMQWIIEYISGEYVRIPNVIYDKGTKGKEAMIRFWTKNMEEMIEALDNLLKML"
     MGSSWKYESE KAMIKPVGMT VAGLDTGNGA GGETDLRVFE VLGIHGVFAI TAITAQSTRG        60
     IKDINVVSSE FLKKQIETLL DDFNVEAVKM GMIYTKEQFQ VVNELLHDSF LVVDPVLYAK       120
     DGTPLIKDVE DYKKIILPIA KVITPNIIEA SAISGIKVEK ESDVVIACKK IRETYNIAHV       180
     IIKGGHSKGD FSFDYMCNEE GVYKIGYHKI QAKDTHGTGS VFATAFTAEY IKTKDVKLAF       240
     RKARDFVQSP IEYGLNIGKG VGPVNVSIEI MKKSMKYEVV EEMRRFADFA ENNEKFWILI       300
     PEVQSNLAHS IKPEYVRDLN DIATFRGRII RRWDKKVIVG HPVVFGNPTH TARMLLSIIL       360
     KGMNSTCLMN IRYDDKIVES FKEIGYETVE INRELEPSHG EGKTMQWIIE YISGEYVRIP       420
     NVIYDKGTKG KEAMIRFWTK NMEEMIEALD NLLKML                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page