(data stored in ACNUC7421 zone)

EMBL: CP001402.PE203

CP001402.PE203       Location/Qualifiers
FT   CDS             complement(176290..176985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0205"
FT                   /product="MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40839"
FT                   /db_xref="GOA:C4KK98"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C4KK98"
FT                   /protein_id="ACR40839.1"
FT                   /translation="MKKVKVLYFAFIKDITHKSNEVLETECEDVGCLIEQLGKMYGNEL
FT                   VNFLKNGINGIKVSILVNGSASTKNIKDGDEVALLPPPSGGDLIIGKRFDLLEEIRKFR
FT                   EKAPPEAGSLVVYVGFVKGIVDNHKVLELRYEAYEEYTRKRFLEIKEEMKRKYSDLIDL
FT                   EIIHVIESMKPGENVLLIMALGKGRKDAIDAVKETLELVKHSTGIWKLEIRDDGEYWVV
FT                   AGNTRVKKQ"
     MKKVKVLYFA FIKDITHKSN EVLETECEDV GCLIEQLGKM YGNELVNFLK NGINGIKVSI        60
     LVNGSASTKN IKDGDEVALL PPPSGGDLII GKRFDLLEEI RKFREKAPPE AGSLVVYVGF       120
     VKGIVDNHKV LELRYEAYEE YTRKRFLEIK EEMKRKYSDL IDLEIIHVIE SMKPGENVLL       180
     IMALGKGRKD AIDAVKETLE LVKHSTGIWK LEIRDDGEYW VVAGNTRVKK Q                231
//

If you have problems or comments...

PBIL Back to PBIL home page