(data stored in ACNUC7421 zone)

EMBL: CP001402.PE207

CP001402.PE207       Location/Qualifiers
FT   CDS             180476..181276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0209"
FT                   /product="Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40843"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA2"
FT                   /protein_id="ACR40843.1"
FT                   /translation="MDKAQDSKSWSIRDIIPENHPRRESLLIREKLIEAMEKSILVPQG
FT                   LIAHGRGECFDYLIGEKTQDFAEKAIEAAAATLLLAKTPVISINGNMAALVPEGLVRLA
FT                   EETNAKLEVNLFYRDERREKVIAEVLYKANAKEVLGVGEDASTVIPELFSQRRRVSPKG
FT                   IYIADVVLLGLEDGDRTEALVKMGKKVIAIDINPLSRTSRTATITIVDNIIRAIPRLVE
FT                   KVKEFKSKNKEELEQIVLNYNNKNVLAESLKFIANRLTQLSFSL"
     MDKAQDSKSW SIRDIIPENH PRRESLLIRE KLIEAMEKSI LVPQGLIAHG RGECFDYLIG        60
     EKTQDFAEKA IEAAAATLLL AKTPVISING NMAALVPEGL VRLAEETNAK LEVNLFYRDE       120
     RREKVIAEVL YKANAKEVLG VGEDASTVIP ELFSQRRRVS PKGIYIADVV LLGLEDGDRT       180
     EALVKMGKKV IAIDINPLSR TSRTATITIV DNIIRAIPRL VEKVKEFKSK NKEELEQIVL       240
     NYNNKNVLAE SLKFIANRLT QLSFSL                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page