(data stored in ACNUC7421 zone)

EMBL: CP001402.PE209

CP001402.PE209       Location/Qualifiers
FT   CDS             complement(181955..182689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0211"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40845"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKA4"
FT                   /protein_id="ACR40845.1"
FT                   /translation="MLLWLRNLLYAFEIIYKMIGTVKDRTLEALLKYGDKAKYVLKAII
FT                   EITEDNENRELGDFSYKQLVEKLGEFGVNYDPRMILRALEKDFGIIETTYKSANQHWWK
FT                   FIDIEQTKLALNGEINNSEEDPEISLIIIQYNSLNPKEVEKKLLFLLKKPKLLDLDKKN
FT                   FMKFSFEILPLIVKLYYKASQHEDTFEIAEKLKKIINLAKRISSRINNEKGDNKGLHKE
FT                   EINEGENYNINSIRLPNGEDNI"
     MLLWLRNLLY AFEIIYKMIG TVKDRTLEAL LKYGDKAKYV LKAIIEITED NENRELGDFS        60
     YKQLVEKLGE FGVNYDPRMI LRALEKDFGI IETTYKSANQ HWWKFIDIEQ TKLALNGEIN       120
     NSEEDPEISL IIIQYNSLNP KEVEKKLLFL LKKPKLLDLD KKNFMKFSFE ILPLIVKLYY       180
     KASQHEDTFE IAEKLKKIIN LAKRISSRIN NEKGDNKGLH KEEINEGENY NINSIRLPNG       240
     EDNI                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page