(data stored in ACNUC7421 zone)

EMBL: CP001402.PE21

CP001402.PE21        Location/Qualifiers
FT   CDS             18766..20697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0021"
FT                   /product="protein of unknown function DUF255"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40657"
FT                   /db_xref="GOA:C4KJD7"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJD7"
FT                   /protein_id="ACR40657.1"
FT                   /translation="MNERLRNSQSGYLRKAVNHPINWYTWSNEIFEIAKREDKPILIDV
FT                   GAAWCHWCNVMDEDTYSNPEIVKIVNENFIPVKVDRDEMPDLDRLLQNAAMTITGESGW
FT                   PLTIFMTPEGKVFFGGTYFPPEDKYGRIGFKKLLLEILRIWREDRNQIFSSSIDPNMLI
FT                   ARNTGGVLSSSVLDDAFSYITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSATRGDDLGK
FT                   KLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYTATN
FT                   DIEILDALRNSVDFVLRELYMDGKGFANSLDADSEGMEGKYYTWTEDELKGALGNDYGI
FT                   AIRVFDLKNTVEVEGRKVLLRTTELRELSKVTGLQANEIIEKVSEIRAKLLTYREQNRK
FT                   MPYRDDSTYTYPNAKLTESILFSSLILNKGIEEAKLVLSKLGKSVSRRLDGGKAGLPED
FT                   YAAALLASISAYEVLSEEKYYDLAIELGRNIGGIRPNNFTDMPNESANSMYIRALFKLS
FT                   LLSDEFKVDEGKIKPLIPSLTAENSQFIAGIVNTISSYINGMAHIVVVDEKDGLAERLH
FT                   RTALLTYYPFKLIERVDDSRTDYVSSVIRAMIKYNAGKSRAYVCIGNTCSMPVSEEEKI
FT                   KQLLKTKL"
     MNERLRNSQS GYLRKAVNHP INWYTWSNEI FEIAKREDKP ILIDVGAAWC HWCNVMDEDT        60
     YSNPEIVKIV NENFIPVKVD RDEMPDLDRL LQNAAMTITG ESGWPLTIFM TPEGKVFFGG       120
     TYFPPEDKYG RIGFKKLLLE ILRIWREDRN QIFSSSIDPN MLIARNTGGV LSSSVLDDAF       180
     SYITSYFDIE YGGLGFGAKF PHPFVDLLFL NYSATRGDDL GKKLGLFTLR KMYYGGIFDQ       240
     VGGGFHRYTV DREWKLPHFE KLLIDNAELI YDYFTYYTAT NDIEILDALR NSVDFVLREL       300
     YMDGKGFANS LDADSEGMEG KYYTWTEDEL KGALGNDYGI AIRVFDLKNT VEVEGRKVLL       360
     RTTELRELSK VTGLQANEII EKVSEIRAKL LTYREQNRKM PYRDDSTYTY PNAKLTESIL       420
     FSSLILNKGI EEAKLVLSKL GKSVSRRLDG GKAGLPEDYA AALLASISAY EVLSEEKYYD       480
     LAIELGRNIG GIRPNNFTDM PNESANSMYI RALFKLSLLS DEFKVDEGKI KPLIPSLTAE       540
     NSQFIAGIVN TISSYINGMA HIVVVDEKDG LAERLHRTAL LTYYPFKLIE RVDDSRTDYV       600
     SSVIRAMIKY NAGKSRAYVC IGNTCSMPVS EEEKIKQLLK TKL                         643
//

If you have problems or comments...

PBIL Back to PBIL home page