(data stored in ACNUC7421 zone)

EMBL: CP001402.PE216

CP001402.PE216       Location/Qualifiers
FT   CDS             complement(186179..186814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40852"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB1"
FT                   /protein_id="ACR40852.1"
FT                   /translation="MVLKYFGHSCVLIDDKILIDPHDGGSIGLPKPDIKKVDLILITHD
FT                   HYDHNAYQIFEYKDLKMNFYGSLNYVNYTIRGIKSYHDKYNGKLRGQNSIYVIQKNDGE
FT                   KIVHLGDIGHLPDESIYKELYGANVLLIPIGGVITINYKEALEIIDKVSPKIIIPIHYW
FT                   IKGHYMPLDPPEEFLSNIKYEVRGIDLKNNLIDEKIEESKKLVYILSY"
     MVLKYFGHSC VLIDDKILID PHDGGSIGLP KPDIKKVDLI LITHDHYDHN AYQIFEYKDL        60
     KMNFYGSLNY VNYTIRGIKS YHDKYNGKLR GQNSIYVIQK NDGEKIVHLG DIGHLPDESI       120
     YKELYGANVL LIPIGGVITI NYKEALEIID KVSPKIIIPI HYWIKGHYMP LDPPEEFLSN       180
     IKYEVRGIDL KNNLIDEKIE ESKKLVYILS Y                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page