(data stored in ACNUC7421 zone)

EMBL: CP001402.PE218

CP001402.PE218       Location/Qualifiers
FT   CDS             complement(188015..188644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0220"
FT                   /product="protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40854"
FT                   /db_xref="GOA:C4KKB3"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB3"
FT                   /protein_id="ACR40854.1"
FT                   /translation="MNFYKIVRSWFGFKERDDYISASILNYLVTKEYDESELRDIIKGR
FT                   EIAVVGASPQLDKINKIEEDVIIAADGATNYLINIGVIPDIVVTDLDGLQTFHKNPIYL
FT                   VLAHGDNISLLPKVKEMDKVIPNSQVMPFGRLRLYGGFTDGDRAVVLAKYMGARKIRLY
FT                   AMDFESGIIGKYSKPYYKRDVPASMIKRKKLEIARMIIEQVLNYDE"
     MNFYKIVRSW FGFKERDDYI SASILNYLVT KEYDESELRD IIKGREIAVV GASPQLDKIN        60
     KIEEDVIIAA DGATNYLINI GVIPDIVVTD LDGLQTFHKN PIYLVLAHGD NISLLPKVKE       120
     MDKVIPNSQV MPFGRLRLYG GFTDGDRAVV LAKYMGARKI RLYAMDFESG IIGKYSKPYY       180
     KRDVPASMIK RKKLEIARMI IEQVLNYDE                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page