(data stored in ACNUC7421 zone)

EMBL: CP001402.PE219

CP001402.PE219       Location/Qualifiers
FT   CDS             complement(188641..188841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40855"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB4"
FT                   /protein_id="ACR40855.1"
FT                   /translation="MNITIDLDSYTCSNDRLEAIEYLLHNNVIFKINLKNPYFETIKGK
FT                   YNIDIIKEEGDIIYFIVRSDG"
     MNITIDLDSY TCSNDRLEAI EYLLHNNVIF KINLKNPYFE TIKGKYNIDI IKEEGDIIYF        60
     IVRSDG                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page