(data stored in ACNUC7421 zone)

EMBL: CP001402.PE220

CP001402.PE220       Location/Qualifiers
FT   CDS             complement(188825..189217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40856"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB5"
FT                   /protein_id="ACR40856.1"
FT                   /translation="MDKSLVAAEYLLRARRTLKEAQIAFEDGDLYYTVVRSLDTIENLA
FT                   RVLLALKDIFRYELLWNTTIMLNDESNIEKKLRDLELKLIPITLINESSLKTPTVIIRN
FT                   KEAEMLVDEITKILEEVEGIYDEYHD"
     MDKSLVAAEY LLRARRTLKE AQIAFEDGDL YYTVVRSLDT IENLARVLLA LKDIFRYELL        60
     WNTTIMLNDE SNIEKKLRDL ELKLIPITLI NESSLKTPTV IIRNKEAEML VDEITKILEE       120
     VEGIYDEYHD                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page