(data stored in ACNUC7421 zone)

EMBL: CP001402.PE222

CP001402.PE222       Location/Qualifiers
FT   CDS             189620..190123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40858"
FT                   /db_xref="UniProtKB/TrEMBL:C4KKB7"
FT                   /protein_id="ACR40858.1"
FT                   /translation="MNENAESYLKERISITLPILNISVPCNTTCIMTSKYKHLLSIENF
FT                   KAQLEILDSLINLIEDKIYTLRYEIEDKFSHYKANINIDNLVYAIYKMIEEGGNMVLGE
FT                   KIYFGNKEVAYGDYTVLIGFHSLVEKIVKTDSNIRSLCDEIRYLSESTWEHFDKNIRRS
FT                   LNES"
     MNENAESYLK ERISITLPIL NISVPCNTTC IMTSKYKHLL SIENFKAQLE ILDSLINLIE        60
     DKIYTLRYEI EDKFSHYKAN INIDNLVYAI YKMIEEGGNM VLGEKIYFGN KEVAYGDYTV       120
     LIGFHSLVEK IVKTDSNIRS LCDEIRYLSE STWEHFDKNI RRSLNES                     167
//

If you have problems or comments...

PBIL Back to PBIL home page